SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HH90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HH90
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 7.15e-39
Family Platelet-derived growth factor-like 0.00000863
Further Details:      
 
Domain Number 2 Region: 126-173
Classification Level Classification E-value
Superfamily Heparin-binding domain from vascular endothelial growth factor 6.41e-22
Family Heparin-binding domain from vascular endothelial growth factor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091HH90
Sequence length 173
Comment (tr|A0A091HH90|A0A091HH90_BUCRH) Vascular endothelial growth factor A {ECO:0000313|EMBL:KFO86728.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_08441 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
LLVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFKPSCVPLMRCAGCCGDEGLECVPV
DVYNVTMEIMRIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKRGKGKGQKRKRK
KGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNERTCR
Download sequence
Identical sequences A0A087V7C8 A0A091HH90 A0A091KCS3 A0A091L5E4 A0A091LV95 A0A091QYV9 A0A091TPH5 A0A091UWR3 A0A093EWC7 A0A093IJK5 A0A093IXE6 A0A0A0A6I6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]