SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HJ09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HJ09
Domain Number 1 Region: 513-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000419
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 12-59
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091HJ09
Sequence length 559
Comment (tr|A0A091HJ09|A0A091HJ09_CALAN) Complement component C8 alpha chain {ECO:0000313|EMBL:KFO96278.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_00612 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
RSSRDVNSPAPVNCQLSQWSAWTDCFPCQEKKHRYRRLLQPAGFAGQRCAGHLWDEQSCR
AETSCTRTSSCGKDFQCQETGRCIKQHLVCNGELDCRDGSDEENCEDEDIESSCEHLSPI
PGAEKAAQGYNILTQEERLHVYDPKFFGGHCEQVYNGEWRELKYDAACERLSYGDDEKYF
RKPYNFHLYQFLAHADSGFTFEFYDDSKDLLDALKSDKSKTTGFTIGIGPANSDFQITLG
LTLSGGKGSLKNFTQYATKELGFIRVAMKVQTARFKMRRDKIVLDEDVLLSLQELPDTYN
YGMYAKFINDYGTHFITSGTMGGTFEYILVINKEEMRRKDISAEEISSCFGLSIGLSVSE
SFLNLGTSVSFSQCEKKGFLKTDAESHSAVVEDIISQIRGGDTSFSTGLLNSWDGKMSRH
WGRSLKYNPAVIDFELQPIHEILRRSDLGGVETKRANLQQALDEYLLEFNACRCQACQNN
GEPILVGDICSCQCPSGYGGPACEQTKRQGGEIDGHWSCWAEWGPCQSGRALRSRQCNNP
APQRGGKPCAGRDQQSKAC
Download sequence
Identical sequences A0A091HJ09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]