SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HMS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HMS1
Domain Number 1 Region: 38-143
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.51e-16
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 2 Region: 147-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091HMS1
Sequence length 260
Comment (tr|A0A091HMS1|A0A091HMS1_BUCRH) R-spondin-1 {ECO:0000313|EMBL:KFO88633.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_06770 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
MQLGLFVVVVFLSSMDLTGSSKAVKGKRQRRISTELSQGCARGCDLCSEFNGCLRCSPKL
FILLERNDIRQIGICLPSCPLGYFGLRNTDMNKCIKCKIENCESCFSRNFCTKCKEGLYL
HKGRCYITCPEGYSAANGTMECSSPAQCEMSEWGPWGPCSKKRKLCGFKKGNEDRTRRIL
LAPSGDVSLCPATTEVRRCTVQKNQCPEGKRKKKEEQGKQDNTNGNRNRKDTKDAKSGTK
KRKSKQRGATVPTTATSPAQ
Download sequence
Identical sequences A0A091HMS1
XP_010132630.1.100080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]