SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HNN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HNN1
Domain Number 1 Region: 301-412
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000981
Family Pseudo ankyrin repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091HNN1
Sequence length 1124
Comment (tr|A0A091HNN1|A0A091HNN1_CALAN) Transient receptor potential cation channel subfamily M member 5 {ECO:0000313|EMBL:KFO96742.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_06487 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
MEEMETKLCSTDKEEDLKRALPYCLGEIDFTASGKKRGKFIKVPCTIHPGIIFEVLLNKW
KIPAPNLVVSLVGEEENFQMKPWLQDTLKKGLTKAAQSTGAWIFTSALRVGITRHLVQAV
RDHALASTSSSVRVIAIGITSLRKIQHREILENTKNETLVHYQSDDNIQGPLRSLDHNHS
HFILVDDLAPAEPDGTTRLRLTLEKYISEQRTGYGGTGSIEIPVLCLLVNGGPGTLERIC
IGLENSAPWLILAGSGGTADILAAFINDPQLLMPEAVQQQFKEKFPAESFSWKDILQWTA
TIHNIISHQNLLTLHNFEQDGSEEFDTVILKALVKACKSQSQEAQEYLDELKLAVAWNRV
DIAKSEIFNGDVEWKSCDLEEVMMDALVNDKPEFVKLFIDNGANIAEFLTYSRLQRLYCS
ISQKCLLYELLLKKHEESKLTLAGLTAQQNKEQEICPLFTLSEVSRVLKDFLQDACKGFY
QDFIHGGKKKCDKMNAKRLPGPLDMNQKTKNPWRDLFVWAVLQNRHKMANYFWAMGQEGV
ASALAACKILKAMSRLETETKVAQIMKEAKYEQLAVGLFNECYHNSEERAFALLVRKNQY
WSKTTCLQLATEADAKSFFAHDGVQFLTKIWWGDMATSTQILKLISAFWCPFLIYTNLIA
FSEDQQSKNEPEPFKELDGLETEKTLFFSKEEDRGNGKLEKQNPSENTAWVTFIFTRWRK
FWSAPVTVFTGNVIMYFAFLFLFTYVLLLDFKPPPPEGPSTTEITLYFCVFTLVLEEIRQ
SFYTDEDTNLMKKFKLYVEDNWNKCDMVAIFLFIIGVICRMLNSTFQAGRTILAIDFMVF
TLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVTTQALLHPDDTRVEWI
FRRVLYRPYLQIFGQIPLDEIDTSRMYPRNCTSDPLQTLQENFPSCPNSYANWLVILLLV
IFLLVTNVLLMNLLIAMFSYTFQVVQGNADIFWKIQRYNLIVEYHSRPALAPPFIIINHI
TLVLRRIFNKMEHKKEHLERDLPVGLDQKIITWELVQKENYLVNLEQERKESNEERLKAT
SNKVDNLSKYFSGLKEQEKRFKVMEAQICYCTAVISSMAEVLTK
Download sequence
Identical sequences A0A091HNN1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]