SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HPI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HPI5
Domain Number 1 Region: 514-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 2 Region: 73-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000164
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 12-60
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091HPI5
Sequence length 559
Comment (tr|A0A091HPI5|A0A091HPI5_BUCRH) Complement component C8 alpha chain {ECO:0000313|EMBL:KFO89233.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_12212 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
RSSRDVNPAAPVDCQLSQWSEWTDCFPCQEKKHRYRRLVQPARFTGRQCMGYLWDEQACH
AGTSCAGRPSCGKDFQCEETGRCIKRHLVCNGERDCRDGSDEDNCEDEDIESPCEQLFPV
PGSEKAGQGYNILTQEEKQYIYDPNFLGGHCEYVYNGEWRELKYDAACERLYYADDEKYF
RKPYNFHIYQFLAHADSGFAFEFFDDSKDLFDALKSDKSKTEGFTIGTEPGKSPFQLNLG
LTLSGGKGSLKNFTQYTAKEVGFIRGSTKVQTARFKMRRDNIVLDEDVLLSLQELPDTYN
YGMYAKFIDDYGTHFMTSGTMGGIFEYILVINKEEMRKKDIRAEEISACVGLSIGITATE
SNLDLGTSLSSSDCKKKGFLRTDSESHSAVVEDIIPRIRGGDTSYSKGLLSSWDGNMYRH
WGRSLKYNPAVIDFELQPIHEILRRSNLGNMETKRQNLKRALDEYLLEFNVCRCGPCQNN
GEPVLVGDTCFCQCRPGYRGPACEQTERRGGETNGQWSCWSEWGPCQSGTARRSRQCNNP
APQHGGKPCAGRDLQSKAC
Download sequence
Identical sequences A0A091HPI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]