SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HRD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HRD1
Domain Number 1 Region: 5-71
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000719
Family SNARE fusion complex 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091HRD1
Sequence length 92
Comment (tr|A0A091HRD1|A0A091HRD1_CALAN) BET1-like {ECO:0000313|EMBL:KFO97734.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_10639 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
GQSPDAMEDMLDVENKRMTDSLASKVTRLKALALDIDKDAEEQNRYLDGMDSDFLSVTGL
LSGSVKRFSTVVRSGRDNRRLLCSVSAGLVLI
Download sequence
Identical sequences A0A091HRD1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]