SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091I6A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I6A2
Domain Number 1 Region: 211-422
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.49e-58
Family Reprolysin-like 0.00037
Further Details:      
 
Domain Number 2 Region: 508-564
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000106
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 1452-1510
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000497
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 1341-1404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 5 Region: 795-851
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000105
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 6 Region: 913-965
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1399-1453
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000602
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 8 Region: 1296-1346
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000706
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 9 Region: 846-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000183
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091I6A2
Sequence length 1565
Comment (tr|A0A091I6A2|A0A091I6A2_CALAN) A disintegrin and metalloproteinase with thrombospondin motifs 12 {ECO:0000313|EMBL:KFP02885.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_07133 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
EQFIKTLPEYHVVDPARVDANGHFLSFDLHYYISNTRKKRDPSKKENVVYYKINHKETDL
FFNLTVHAGFVSHNYIVERRRGNHTNAKIATRSGVPCHFIGTVLQAGFGSGTAAISACNG
LTGYFHLPHGDYFIEPIKKHSHKEGTPHPHIIYGTNILQNTSRRRRAIPMEKKQACGLND
TISFYKQQQQQRERWQQNHTTLRKVSRRSVSKERWVETLVVADSKMVEYHGSDHVESYIL
TIMNMVTGLFHNPSIGNAIHIVLVRLILFEEEEQGLKIVHHADKTLASFCKWQKSVNPKS
DVNPTHHDVAVLLTRKDICAGMNRPCETLGLSHLSGMCQPHRSCNINEDSGLPLAFTIAH
ELGHSFGIQHDGKENDCEPVGKRPYIMSRQLQYDPTPLTWSQCSKEYITRFLDRGWGFCL
DDIPKKEVLKSPIMAPGVIYDVHHQCQLQYGSNATFCEDVDNLCQTLWCSVKGSCRSKLD
AAADGTRCGENKWCFSGECITVGKTPEAIHGGWGVWSSWSHCTRTCGAGVQSAERPCDNP
EPQFGGDYCTGERKRYRMCNIIPCRKGLPTFRQMQCSEFDTVPYQNEFYHWVPVYNTANP
CELHCRPINGHFSEKMLDAVTDGTPCFEGRHSRDTCINGMCKAVGCDYEINSNATEDQCG
VCLGDGSACHTVKMIFNQSEGFGYVDIGLIPKGARGIKVMEVAEAGNFLAVRSKDPEKYY
LNGGFIIQWNGEYKVAGTIFQYDRTGDLENLTAPGPTNESIWIQLLFQETNPGIKYEYTV
RKEESNENEIGELEYFWQYGDWTACSVTCGRGVRRQVALCMRKGRGAIKNSFCDPATQPN
GRQKKCYEKDCPPRWWAGEWQKCSTTCGPTGQKKRTVLCIQTMGSDEQALAVTACQHLLK
PKTHMSCNRDVLCPSDWTVSNWTECTVTCGGGIRNRNVTCAKNSDEPCDVSKRPNSKALC
GLQQCPSAGRFWLPPLAPKRGKIIIRKTISNPKRSPPHRIPVPSPTCHTTTKSPKLEKVA
SSLPTSSGLGNVSEKEGKGNKTLHKNFAGPGDVYNYPAVSAENSSHQNTNSWPFHNASST
EIIRHAENISEREPDSTVESEVQRSKDTPVFFFTSSPEITSRYDYLSEESDDIDRSVGGS
EKPLDILDSTELTPGIRPTSTTPDTSPPVLKKSVTSQPTPGSHHQEPSTLLPVNKAAQGL
AFPTANHISLQVHVPVVELTTQEASVTVMTTVFGHVPRDQTDNRREMKLLDVMTSSTPSV
ALKHVLRNQNATSMGELANATSSSHLVTTNNMPADAYWIVGNWSECSTTCGMGAFWRHVE
CSSGNISHCQYMKKPDPARKCYLRPCASWKTGNWSQCSANCNGGFKMRDVYCIDVREKRL
LRHFHCQLLGYKPQMSTSCNMEPCLQWHVEPWNECSRTCGGGQQNRRIYCPEEGSCDWTK
RPNTTASCNRQPCTQWLNQSWGPCTVSCGGGMQQRAVKCMNIETNKTEDDSMCANKPKPT
GYQKCNLQDCRKSTGLPCNKDQLSIHFCQRLKGTGKCLLPSIQTQCCFTCSQPRIHNKPR
YWDQR
Download sequence
Identical sequences A0A091I6A2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]