SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091I8D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I8D5
Domain Number 1 Region: 8-218
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.72e-54
Family Reprolysin-like 0.00098
Further Details:      
 
Domain Number 2 Region: 306-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000366
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 637-686
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000549
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 689-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000916
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091I8D5
Sequence length 730
Comment (tr|A0A091I8D5|A0A091I8D5_CALAN) A disintegrin and metalloproteinase with thrombospondin motifs 15 {ECO:0000313|EMBL:KFP04472.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_02536 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
RAKRFASVPRYVETLVVADESMVKFHGDDLQHYLLTLMATAARLYKHPSIRNPIQISVVK
FLLIGQDEKGPKVTGNAALTLRNFCAWQKKWNKVSDKHPEYWDTAILFTKQDLCGATTCD
TLGMADVGTMCDPKRSCSVIEDDGLPSAFTTAHELGHVFNMPHDNVKACEEVFGRLKTNH
MMSPTLIQIDRANPWSACSAAIITDFLDSGHGDCLLDQPAKPIPLPEDLPGSSYSLNQQC
ELAFGVGSKPCPYMQYCAKLWCTGKARGQIVCQTRHFPWADGTSCGEGRFCLKGACVERH
NISKYRVDGGWAKWAPYGQCSRTCGGGVQLAKRDCTHPVPANGGSYCQGVRLKYRSCNLE
PCSAAVPGKSFREEQCEAFNGYSHSTNRLTASVSWVPKYSGVSPRDKCKLICRANGTGYF
YVLAPKVVDGTPCSPDSTSICVQGKCIKAGCDGKLGSKKKFDKCSVCGGDNKSCKKVSGL
FTKPMHGYNFVVVIPAGASNIDIRQRGYKGLISDDNYLALKNGQGKYLLNGHFIVSAVER
DLMVKGSVLRYSGTGTAVESLQAFKPIQEPLTLEVLSVGKMTPPRVRYSFYLPKESKEDK
ASYKKEGNNKAPPDLNNSVLSLSNRLDGGRPNYKRPSYKWATGGWEACSVTCGDGLQKRS
VACHDSYGQPATDCDMAQRPAEVRLCGEPCPSWEAGPWSPCSKSCGRGFKRRGLKCLVPQ
SGRLLPRESC
Download sequence
Identical sequences A0A091I8D5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]