SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091I8K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I8K0
Domain Number 1 Region: 161-295
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.65e-45
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000336
Further Details:      
 
Domain Number 2 Region: 1-158
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.58e-35
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 361-463
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.66e-24
Family Ubiquitin-related 0.0015
Further Details:      
 
Domain Number 4 Region: 287-382
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000114
Family Ubiquitin-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091I8K0
Sequence length 465
Comment (tr|A0A091I8K0|A0A091I8K0_CALAN) 2'-5'-oligoadenylate synthase-like 2 {ECO:0000313|EMBL:KFP04899.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_10019 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
EFLKQQDFEKNIRVQKTVKGGSTGKGTALKNNSDADVVLFINYFSSYEKQKQDKERLYIL
KLIEERLHICRDRVDFTVSISKPWYKCPSNAPRSLSFSLCSKNSESTEVDLLPAYDALGP
VIKDVPPDTNVFVKLLNACSSPGEFSPCFTELQKKFVKRCPPKLKNLVRLVKYWYKELVK
AEHPNADLPPKYALELLTIYAWEVGTNSNKNFVTAEGFRTVLELLRQHQEICIYWEEFYS
LQNRQIGDHVKRLLGSCRPVILDPADPTGILGQGKRWDLLEKAAASHLAQLPCIKNIRAW
VVEPARPVEIVVKQLTGTRLSKTISPSTTIWQLKEEVEKVWGIPWYQQRLAMQEPLRGNG
VLQNHGTLASHGIFYNTTLTLLQTDPQEMEVFVQDNKTTTYRVQPTLTVRQLKEMIHRQH
GPAPDQQRLIYNCTDMQDKYTLAYYKVHPRSTIQLVGRLRGGAGP
Download sequence
Identical sequences A0A091I8K0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]