SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091I8S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I8S9
Domain Number 1 Region: 193-293
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.28e-37
Family ets domain 0.0000894
Further Details:      
 
Domain Number 2 Region: 9-116
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.61e-25
Family Pointed domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091I8S9
Sequence length 298
Comment (tr|A0A091I8S9|A0A091I8S9_CALAN) ETS homologous factor {ECO:0000313|EMBL:KFO96160.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_01957 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
MILEGTGRMSINPSSNLLPQQPSWTDGYSTCNVSSSFYATQWHEIHPQYWTKFQVWEWLQ
HLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTQAAGTAGQLLYSNLQHLKWNGQCGSD
MYQSHNVIVKTEQADPPLMVSWKEENYLYDSGYGSTIELLDSKTFCRAQISMAAPSHQPP
DSSDVKKSQDQTPKSHTKKHNPRGTHLWEFIRDILLNPEKNPGLIKWEDRAEGVFRFLKS
EAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN
Download sequence
Identical sequences A0A091I8S9
XP_008496894.1.100939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]