SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091I8T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I8T0
Domain Number 1 Region: 159-501
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-84
Family Protein kinases, catalytic subunit 0.000000301
Further Details:      
 
Domain Number 2 Region: 6-156
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-43
Family Regulator of G-protein signaling, RGS 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091I8T0
Sequence length 531
Comment (tr|A0A091I8T0|A0A091I8T0_CALAN) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_13019 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
KSKKWRQMLRFPHISLCEDLRQSLERDYHSLCEKQPIGHELFRQFCETRPELSRCVKFLD
AVAGYEVAPDEKRKECGQHLIEKYLKPNSEDHVPEVPLHLVDACCERLEQEPSKELFKES
TKLIHDYLSVAPFADYLDSLYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQV
RATGKMYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTL
MNGGDLKFHIYHMGEAGFEEPRAAFYAAEICCGLEDLHQERIVYRDLKPENILLDDHGHI
RISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNERYTFSPDWWALGCLVYEMIEGQSPF
QQRKKKIKREEVERLVKEVQEEYSEKFSPCARSLCTMLLCKDPLERLGCRGAGAKEVKEH
PLFKHLNFRRLEAGMLDPPFKPDPQAIYCKDVLDIEQFSTVKGVELEPTDNDFYQKFATG
SVSIPWQNEMIETECFKELNVFSTDGTVPPDLDWKGQPSPQPKKGLLQRLF
Download sequence
Identical sequences A0A091I8T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]