SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091I982 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I982
Domain Number 1 Region: 157-359
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.44e-49
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 450-507
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000105
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 872-922
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 748-807
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 5 Region: 807-869
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000811
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091I982
Sequence length 992
Comment (tr|A0A091I982|A0A091I982_CALAN) A disintegrin and metalloproteinase with thrombospondin motifs 14 {ECO:0000313|EMBL:KFP03895.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_07724 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
LYFNVTVFGKELHLRLRPNRRLVPRGAVAEWQEDFEVLFREPLQQHCLFTGDISGMPGAA
VAISNCDGLAGLIRTDSNEFFIEPLERGQQEMEEHGRAHVVYRRSAIRQDGADPHQDLHP
EVPGVQLGDLPNSLEMMTERLGGDTERKRRHARKDDYNIEVLLAVDDSVVRFHGKEHVQN
YVLTLMNIVDEIYHDESLGVHINIVLVRMIMVGYRQSVSLIERGNPSRSLEQVCRWAHSQ
QRSSPEHAEYHDHAVFLTRQDFGPAGMQGYAPVTGMCHPLRSCTLNHEDGFSSAFVIAHE
TGHVLGMEHDGQGNRCADETSMGSIMAPLVQAAFHRYHWSRCSKQELTRYIRSYDCLLDD
PFEHQWPTLPKLPGINYSMDEQCRFDFGVGYKTCTAFRTFDPCKQLWCSHPDNPYFCKTK
KGPPLDGTECSPGKWCFKGHCIWKTSEQPYSQDGGWSSWSKFGSCSRTCGGGVRSRSRSC
DSPLPAYGGHHCPGATYEYQVCNVEECPGPYQDFRAQQCSKRNSYYTHQNSKHTWLPYEH
HDDAQKCELICQSEGTGAVVFMNQVVHDGTRCSYRDPYSICVRGECVHVGCDKEVGSLKQ
DDKCGVCGGDNSHCRTVKGTLAKTPKQPASVLKMFEIPAGARHLQIEEMEPASHSITVKN
QATGDFVLKAKGKEAKSRVFIEMGLEWEYTIEHGKESLKTSGPLHEAISVLVIPQEEEAR
SSLMYRYIIHEDLLPMIGNNDVLLEEMDSYEWALKSWSQCSKACGGGIQYTKYGCRRKSD
NRMVHRNFCDNSKKPKPIRRRCNLQECSQPSWVAEEWGACSRSCGKLGVQVRGVQCLQRL
QNGTNRTLHPKYCPGQRPETRRPCSRLPCPAQWRTGAWSECSSSCGEGVQQRQVVCKGSE
SGNGHCEGDKPEAIRGCHVAVCPGKLSGITTDTGDHGVPKGQRVPQDGPKNPVSKISSRE
PCLGDKSIFCQMEVLARYCSIPGYNKLCCESC
Download sequence
Identical sequences A0A091I982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]