SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IA58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IA58
Domain Number 1 Region: 114-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.42e-44
Family variant PHD-like domain 0.000037
Further Details:      
 
Domain Number 2 Region: 192-321
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000199
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091IA58
Sequence length 334
Comment (tr|A0A091IA58|A0A091IA58_CALAN) Protein KIAA1045 {ECO:0000313|EMBL:KFP04260.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_14518 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
MGVLMSRRQTVEKVQKVSLAVSAFKDGLKEQPSTRQRAEAGGSRRGTLEQEVQEGEEEVS
AGPSQTEESSSSKAAWERLRDGRGVEPEEFNRSNRFTPPAFIRPKRELHDDEPPDISLEQ
REQVLNDEMCEICEVWTAESLFPCRICCRVYHDGCLRRMGYLQDDSATEVTETAHTETGW
SCYYCDNLNLLLTEEEMYSLMETLQQCKIIPETCLTLDDFLHYKHLVHKQQFEQPMAEAQ
EEQVSLQFSALDPDKKGQIEWQDFLSHESIRLLQKLRPQNALLRLLTAKERERAREAFLA
LDQDGDGLIGEGECCQARHTWFRKHLKEIPSCSV
Download sequence
Identical sequences A0A091IA58

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]