SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IDT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IDT7
Domain Number 1 Region: 111-224
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000456
Family Regulator of G-protein signaling, RGS 0.0049
Further Details:      
 
Domain Number 2 Region: 395-502
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000162
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091IDT7
Sequence length 514
Comment (tr|A0A091IDT7|A0A091IDT7_CALAN) Regulator of G-protein signaling protein-like {ECO:0000313|EMBL:KFP05540.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_10215 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
PLAAAIASTNIWHLLRDDVFVDFFNTFLNLPVFGQTPVYSNSRSRWDLWPELPSCLDPSP
PDLLAWLEKHRLPHFCKSSLCLHLILCQKLLEFVRSGEAAKLLNWQSADQWLLEKCISGS
QGMWRFRAFIQGTPGEELTDFWLTTERLLGLNKLDAEQRDTYLSLVHRLKATHLREGSSV
VTLCGATSGPKSRCIQTSSTTREMLSMMQEQALFVIQSYWLPKFFIHCKMGMAEEESCQP
LLQEYGERLSRADSQEPSDFSLNLYKMHIKRSRGSSGPYCSKKSKVKIWTMVKVGRNTQE
MKAPGFPAQPGRHLGPVGGREEPCVDKDALGLFPPATPAVGGKGRTTSLQRSNGGQCEDE
ALSDLHPSAPSAQQPAETLSFLPWALSAEGCAGRPFRHFLECQDRPVETQLLDLWQDLEE
FLPVVLDPGRENSFFLRHLIGEKISKSYLGEETIRQLPLEVETLRSLRNHLMAAEFSPWI
YRAQKEICKVLCCSYEEFLADDDRTFLQFMVKGM
Download sequence
Identical sequences A0A091IDT7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]