SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IGT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IGT8
Domain Number 1 Region: 216-497
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-65
Family Protein kinases, catalytic subunit 0.00000486
Further Details:      
 
Domain Number 2 Region: 14-71
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000746
Family Regulator of G-protein signaling, RGS 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091IGT8
Sequence length 506
Comment (tr|A0A091IGT8|A0A091IGT8_CALAN) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_03131 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
GGGGKRKGRSKKWREILRFPHISQCQELRKGLEQDYGSLCQRQPLGRLLFRQFCQTRPEL
LRCIRFLDAVVRDPRAETGVRWGPCPGTGMPWEGVSGLGPQPGLQRVPPRGLWGRQGPPH
PCFSRDGTLHPSKMQLGTHQCLLPGCFFSPFLITFNNSAEVWEGLSGGQRAEPCWCPCLQ
HPPLPTHLRGTTSSPRMRRGRRWGKRSSSSSSSRSLAYAYETKDALCLVLTMMNGGDLKF
HIYNMGNPGFEDERVVFYAAEICCGLQHLHQEGIVYRDLKPENILLDDDGHIRISDLGLA
IKIPEGETIRGRVGTVGYMAPEVINNERYSFSPDWWGLGCLVYEMIEGQSPFRARKERVK
REEVEKRVQEEQEPYSDKFSEDARAICQMLLAKDPKQRLGCGAEGAAEVKSHPFFRTINF
KRLEAGIMTPSFVPDPRAVYCKDVLDIEQFSTVKGVNLDQTDNDFYAKFATGSVSIPWQN
EMIETECFKDLNVFGPSGTRSPDLDR
Download sequence
Identical sequences A0A091IGT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]