SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IH35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IH35
Domain Number 1 Region: 1104-1189
Classification Level Classification E-value
Superfamily Immunoglobulin 5.47e-20
Family I set domains 0.045
Further Details:      
 
Domain Number 2 Region: 742-800
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 3 Region: 1018-1094
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 896-964
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-16
Family I set domains 0.036
Further Details:      
 
Domain Number 5 Region: 402-459
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000157
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 6 Region: 345-403
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 7-59
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 8 Region: 463-520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000602
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091IH35
Sequence length 1240
Comment (tr|A0A091IH35|A0A091IH35_CALAN) Papilin {ECO:0000313|EMBL:KFP07889.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_10739 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
RTKRQIGAWGSWGEWGECSRSCGGGVSFRQRRCYSQRTEGASSCAGPTRSYRSCNVQSCP
EGSQDFRAEQCAEFDGTEFQGKKYNWLPYYGAPNKCELNCIPKGENFYYRHRETVIDGTT
CEPGKRDICVDGVCQAVGCDNMLGSAKKEDKCLQCGGDGSTCYGVKGTFDVPNLPKGYNQ
VFIIPVGATSIQIKEVMPSRNFLAVKNVRGEYYLNGHWTIDFSRALQVASTVVHYDRGSE
GDRAPELLHARGPTTEPLIIELINQEPNPGIQYEYYLPMEGQASGYSWSYGSWRCSLAAS
LGSQSRLVFCTIDNEIYPDYMCRNKPKPENNRTCGQQACPQTKRWKTGEWGPCSATCGGG
TQTRSVYCVAFDGQSSQGVVDNSECMAFAQQPRSSQPCNIRQCATWSTGPWSECSASCGE
GVQTRTVTCRTQQGTQAQDFACLMEPKPSATQPCLKENCIQEISWHVGDWGLCSKSCNSG
IRTRQVTCADGDSKFYSPETCKAIQPQKPATLGSCNTQPCYLPQQVPSVQDTMGYDATRQ
SLLTRYSPNRPATGGFSWDNRKNDSGDERTVPGSSRILNTSGNHHLPPTKDHGINLLPAH
WKSQSRSSGSHQLSFSQDPSARTGSQECHQSPHGCCPDGHTPASGPLGRGCTFSTCHQNR
YGCCPDGVSAAQGPNNMGCPQYYRDTQVSRNHPTAASPTASQALSQMHPAGECRSSVYGC
CFDNVASASGPRGEGCLNRPSYPYPVMCLLPSAHGPCANWTTRWYFVAVVGKCNRFWYGG
CHGNKNSFSSEEECMRTCHSPVGVSPLEHQPSSGALQRQQTASHPPTEDARTAPGGQRSS
TRQVLPGEGKQGHKALGADVSMAEGFGHLASAGSLPAGPLRSGIAFSFRAILEEAKPSLV
TAAVGQNIQLICKTGMSPFSRVQWMKDGRPVSSDRHTQQSDSSLVITHVKPEDAGTYRCL
VSDGRAESRQIQLQIRGLLHQSARKQMAEGLFGSCSASSPKLIETLCERSQLTMDKSEPS
VVEASIGEGARLPCTVEASPALTIEWQKDGKPLASPRYRQQSDGALVISRVSSGDMGFFT
CIASNGRDQDQRRVLFRPLGVLKITGLLPSITVPEGGTAQLHCTVTSNNVNIRWSRNGVP
MRADGHHIHLSPNGSLIINNVQEADEGSYTCSAYSNTNSVSASTEVKVLRSRPATAGNRV
GDLSKECVDQPHLANCELILQAQLCSNGYYSSFCCASCSR
Download sequence
Identical sequences A0A091IH35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]