SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IKB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IKB2
Domain Number 1 Region: 264-392
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.8e-44
Family Regulator of G-protein signaling, RGS 0.0000022
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-21
Family DEP domain 0.0075
Further Details:      
 
Domain Number 3 Region: 197-250
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000405
Family Transducin (heterotrimeric G protein), gamma chain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091IKB2
Sequence length 402
Comment (tr|A0A091IKB2|A0A091IKB2_CALAN) Regulator of G-protein signaling 11 {ECO:0000313|EMBL:KFP07923.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_06828 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
RQMERMIVSMQDPDMGIKMRNQRLLITVIPHAMTGNDIVEWLIQKYGISEEGNLIVKHGY
IYPLRAPSSLVLRADESPYRFQTPYFWTSTKWPATELDYAIYLAKKNIRKQGDLIEHEKD
NYNLLHKRINHTWDFVVMQAREQLRAAKQRRKGDRIVIDCQEQAYWLVNRPPPGAPNVLE
QGPERRNSHTTRVQLIEYKREIEYCRKARASTRVKSSICLEGYLKFNEQYVPHDPIMSGC
LPSNPWITDDTTYWAMNAPAVLTPTKPRVERWGFNFSELITDPLGRTHLLEFLKKEFSAE
NLSFWEACEELRYGEQSRISEIVDSIYQQFLAPGATRWVNIDSKTMERTLEGIKTPHRYV
MDDAQMHIYMLMKKDSYPRFLKSDLYKNLLAEAIIPPETKKR
Download sequence
Identical sequences A0A091IKB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]