SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IQ16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IQ16
Domain Number 1 Region: 13-82
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 77-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000045
Family VWC domain 0.062
Further Details:      
 
Domain Number 3 Region: 175-220
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091IQ16
Sequence length 328
Comment (tr|A0A091IQ16|A0A091IQ16_EGRGA) WNT1-inducible-signaling pathway protein 1 {ECO:0000313|EMBL:KFP10417.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_11853 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
TTEAYTRTQYCKWPCECPKTPPRCSVGVSLVTDGCDCCKTCAKQRGESCTEADTCDFHRG
LYCDYSGDRPRYEIGVCAQIVGVGCVLNGVRYNNGDTFQPNCKYNCTCINGAVGCIPMCT
NSRPPLVWCPNPKLIKMAGKCCEQWICDDSKKIRKTSPRHISSAAYEGEDEAWQKNCIVH
TSSWSPCSKTCGLGISTRISNDNDQCRLLKESRLCNMRPCEVDITKHIKPGKKCLAVYRA
NEPMNYTISGCVSKSPYRPKYCGVCTDNRCCTPYKSKTIEVRFECPDGTEFSWKIMWINA
CFCNLNCKNPNDIFADLAHYHDYSEIAN
Download sequence
Identical sequences A0A091IQ16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]