SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IVZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IVZ9
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.06e-39
Family Regulator of G-protein signaling, RGS 0.000000181
Further Details:      
 
Domain Number 2 Region: 760-841
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.82e-27
Family DIX domain 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091IVZ9
Sequence length 841
Comment (tr|A0A091IVZ9|A0A091IVZ9_EGRGA) Axin-1 {ECO:0000313|EMBL:KFP11610.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_10206 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
MNIQGKGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPVSHGFYSGKSDVVRNETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCTSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLQIDPD
MFDQAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGESPKIYSDPSSGSGTGKGLPGYLPT
LNEDEEWKCDQEAEPEASRDSAPSSRLTQKLLLETATQRAASARRYSEGREFRHGAWREP
VNPYYVNTGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKQHRREMQESA
KANGRVPLPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKRVRAEE
EGEDADISSGPSVISHKMPSAQAFHHFAPRYSEMGCAGMQMRDAHEENPESILDEHVQRV
MKTPGCQSPGPGRHSPKPRSPESGHLAKLSGTLGTIPPGHGKHATKSGMKLDAANLYHHK
HVYHHIHHHSVMKPKEQIEAEATQRVQNSFAWNVDSHNYATKSRNYTENLGMAPVPMDSL
GYSGKASLLSKRNVKKTDSGKSDGASYEMPGSPEDMERNQKILQWIIEGEKEISRHKKTN
HGSSGAKKQLSHDMVRPLSIERPVAVHPWVSAQLRNAVQPSHPFIQDPTMPPNPAPNPLT
QLEEARRRLEEEEKRAGKLPLKQRLKPQKRPGSGASQPCENIVVAYYFCGEPIPYRTLVK
GRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDTILPIFEEKIIGKVEKI
D
Download sequence
Identical sequences A0A091IVZ9
XP_009647717.1.23211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]