SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IWS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IWS0
Domain Number 1 Region: 180-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000173
Family I set domains 0.067
Further Details:      
 
Domain Number 2 Region: 28-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 3 Region: 103-176
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000863
Family Pre-dockerin domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091IWS0
Sequence length 1019
Comment (tr|A0A091IWS0|A0A091IWS0_EGRGA) Cartilage intermediate layer protein 1 {ECO:0000313|EMBL:KFP12777.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_07655 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
GTRSNSHQGDPTFAYARRSPLVQDSKRFLSPWSQWSECSGMCGQTGVQKRTRSCLAERLW
GVHCNEATEEGRLCIGHVCSACNITCPMGRVNADCDACMCEDATLHGKVSLEDGSPAADA
RVYLQAKKLKLLTTADNRGMFRIPGVCPDGKNTLKIKKAKYTTATVTVPKSNRRNLAIQV
RLQRSGKPYIFRSPEDKARRVGQSVSLCCDALGSPAPDRYLWYHNGSLLDPSLYKYKNNL
ILKNLNRDQSGEYFCKASSAGGSAKSQPATLAVIGRQEAACNSQPQSHLIRLPHDCFQKA
TNSFYYDVGKCPAKTCAGKLDKGLRCKDNVAYCCGVSKMETRDISCNGYTLPTKVVIECG
CKKCTETKITVRGRATAADNGEPLRFGHIYMGNKRVSMTGYKGTFSIHVPADTERLVLTF
VDRLQKFVNTTKVLPFKENGGAVFHEIKLLRKKAPVTLESTETNVISLGEMEEDDPIAEL
EIPPNAFYRKNGEAYRGKVKASVTFLDPRNISMATATQSDLNFVDEEGDVFPLRTYGMFS
VDFTDEQGTESLNAEEVKVHLDAAQVKMPEHLQEMKLWSLNPETGLWEEEGDFNLEKSRR
RKREERTFLVGNMEIKERRLFNLDVPESRRCYIKVRAYRSERFLQSEQIQGVVISVINTE
PEPGFSSNPRAWGRFDSAVTGPNGACVPAFCDEQNPRAYTAYILASMGGEELEAVSSAPK
LNPNAIGVPQPYLNKLNYRRTDHEDSSTKKTAFSINMAKPSPNSPEENNGPIYAYENLRE
CEEAPYNAAHFRFYRIEGDRYDYNTVPFSEDDLMSWTDDYLAWWPKPMEFRACYIKVKIN
GPQEVNVRSRNMGGTHPRTIGKLYGIRDVRSIRDSEQPDVSAACLEFKCSGMLFDQDRVD
RTLVKVVPQGSCRRESVNSMLHEYLVNHLPMATNNDSSEYTMLAPLDPLGHNYGIYTVTD
QDPRIAKEIALGRCFDGTSDGTSRIMKSNIGVGLTFTCSERSAAEQSIFQSQRNSGQQT
Download sequence
Identical sequences A0A091IWS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]