SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IZN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IZN6
Domain Number 1 Region: 51-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 501-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 455-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000576
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091IZN6
Sequence length 546
Comment (tr|A0A091IZN6|A0A091IZN6_EGRGA) Complement component C8 alpha chain {ECO:0000313|EMBL:KFP13817.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_03051 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
RSSRDVNSAAPVDCQLSQWSEWTDCFPCQEKKVRLHCNVFIYLQMCRAEATCTGPPGCGK
DFRCEETGRCIKQHLVCNGEPDCRDGSDERNCEDEDIEGPCEHLLPVPGSEKAAQGYNIL
TQEGSQYIFDTNFFGGQCEYVYNGEWRELKYDAACEHLYYGDDEKYFRKPYNFHIYQFLA
HADSGFTLEVYDDSNDLLDALRSHKSQMIGFTIGIGPGKLDFQVELGFTLSGGKGSLKNF
TQYTRKEVGFIRGVTKVQTARFKMRKDNIVLDEDLLLSLRELPDTYNYGMYAKFIDDYGT
HFMTSGTMGGVFEYIFVINKEEMRRKDISTEEISACIGLSIGLSVSDIKLHLKTSVSPSG
CVNKGFLKTDAESNSAVVEDIIPRIRGGDTSYSGGLLNSWDGNMYRHWGRSLKYNPAVID
FELQPIHEILRRSNLGDMESKRQNLKRALDDYLLEFNACRCRPCQNNGEPILVGDTCFCQ
CRPGYEGPACEKTKRRGSETDGRWSCWSHWAPCASGTTQRSRQCNNPAPRGSGQPCMGKD
LQSKAC
Download sequence
Identical sequences A0A091IZN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]