SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091J5A8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091J5A8
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily PX domain 2.88e-30
Family PX domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091J5A8
Sequence length 194
Comment (tr|A0A091J5A8|A0A091J5A8_EGRGA) Sorting nexin-10 {ECO:0000313|EMBL:KFP15812.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_16306 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
QEFVTVLVRDPRTQKEDTWHSYIDYEIFIHTNSMCFTRKTSCVRRRFREFVWLRQRLQSN
AVLIQLPELPSKTPFFNMNNPHHVDHRRQGLQEFLEKILQDALLLSDSRLHLFLQTQLSP
EDMEACVSGQTKYSVADAIHKFASLNRRFPIEDEERKKGKNDAETDSESSSSGLGPSDDS
ISCGCKASPASEES
Download sequence
Identical sequences A0A091J5A8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]