SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091J6J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091J6J6
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000293
Family Tudor domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091J6J6
Sequence length 54
Comment (tr|A0A091J6J6|A0A091J6J6_EGRGA) Tudor domain-containing protein 6 {ECO:0000313|EMBL:KFP16619.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_05194 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
LKGFAVGSKCVVWTSLKWCEARILEVSEKGTKVLNLSSGNEEIVDPENVWNGIP
Download sequence
Identical sequences A0A091J6J6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]