SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091J8Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091J8Q4
Domain Number 1 Region: 430-490
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000471
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 375-435
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000484
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 527-581
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 31-79
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 607-664
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000085
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 6 Region: 294-357
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091J8Q4
Sequence length 667
Comment (tr|A0A091J8Q4|A0A091J8Q4_EGRGA) ADAMTS-like 1 {ECO:0000313|EMBL:KFP16972.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_03379 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
MEGCRWTTAGTLLLASLVLSSRTARSEEDRDSLWDAWGSWSECSRTCGGGASYSLRRCLS
SKTCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKYQGQFYEWLPVLNDPDNPCSLK
CQARGAALVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDRQLGSAVKEDNCGVCNGDG
STCRLVRGQYKSQLSANKLDDTVVAIPYGSRQVRLVLKGPDHLYLESKTLQGVKSENSLS
STGSFLVDNSSIDFQKFPDKEILRISGPLSADFTIKIRYTGAADSSVQFIFYQPIIHRWR
ETDFFPCSASCGGGYQLTSAECFDLRSSRVVADQYCHYYPENIKPKPKLQECNLDPCPAS
DGYKQIMPYDLYHPLPRWESTPWTACSSSCGGGIQSRSVSCVEEDIQGHISPVEEWKCMY
TPKMPVVQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHRGMHTGGCSPKTKPHI
KEECIVPTPCYKPKEKLPVEAKLPWYKQAQELEEGAVVSEEPSFIPEAWSTCSVTCGVGS
QMRLVKCQVLLSFSQSVADLPIDECEGPKPVSQRACYSGPCSGEATEYTPEETELLYGGL
QEFDELYDWEYEGFTECSESCGGGVQEAVVTCLNKQTRETADETLCVTSRRPPQLLKACS
LDPCPPR
Download sequence
Identical sequences A0A091J8Q4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]