SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JIH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JIH2
Domain Number 1 Region: 21-149
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-26
Family Pleckstrin-homology domain (PH domain) 0.00001
Further Details:      
 
Domain Number 2 Region: 168-259
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000595
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091JIH2
Sequence length 267
Comment (tr|A0A091JIH2|A0A091JIH2_EGRGA) Signal-transducing adaptor protein 1 {ECO:0000313|EMBL:KFP11446.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_10010 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
EQPEETPRPAPRQISQERQKITGLPLYFQGFLSVRHSRHQEFREYWTELRGTMLFFYDDK
KAPTYSQKLDISTLTSATNVYPDENGSAQFILMLPSGELELKANNCECGKEWKGFILTVT
KLSVPQDASLLPGQLTRMHEVLEKEKKRRITLTDCSRASLNRKSPPSSTLTAMPVCFYAV
SRQEATEMLEKNPSCGNLILRPGSDSKNYAVSIRQELDAPCLKHYKVTSKGTSYIIELER
QVRVPSLQDVVNYFVSQTQGNLKPFVI
Download sequence
Identical sequences A0A091JIH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]