SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JJ98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JJ98
Domain Number 1 Region: 162-504
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-84
Family Protein kinases, catalytic subunit 0.000000286
Further Details:      
 
Domain Number 2 Region: 9-159
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-44
Family Regulator of G-protein signaling, RGS 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JJ98
Sequence length 534
Comment (tr|A0A091JJ98|A0A091JJ98_EGRGA) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_09329 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
RKGKSKKWRQMLQFPHISLCEDLRQTLERDYHSLCEKQPIGHMLFRQFCETRPELSRCVK
FLDAVAGYEVAPDEKRKECGQHLIEKYLKPNSEDHVPEVPSQLVDACCERLEQEPSKELF
KESTKLIHDYLSVAPFADYLDSLYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCA
CQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLV
LTLMNGGDLKFHIYHMGEAGFEEPRAAFYAAEICCGLEDLHQERIVYRDLKPENILLDDH
GHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNERYTFSPDWWALGCLVYEMIEGQ
SPFQQRKKKIKREEVERLVKEVQEEYSEKFSPSARSLCTMLLCKDPLERLGCRGAGAKEV
KEHPLFKHLNFKRLEAGMLDPPFKPDPQAIYCKDVLDIEQFSTVKGVELEPTDNDFYQKF
ATGSVPIPWQNEMIETECFKELNVFSTDGTVPPDLDWKGQPSPQPKKGLLQRLF
Download sequence
Identical sequences A0A091JJ98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]