SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JLC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JLC4
Domain Number 1 Region: 750-977
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-59
Family DBL homology domain (DH-domain) 0.00000000423
Further Details:      
 
Domain Number 2 Region: 344-522
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.22e-54
Family Regulator of G-protein signaling, RGS 0.000000111
Further Details:      
 
Domain Number 3 Region: 981-1104
Classification Level Classification E-value
Superfamily PH domain-like 1e-35
Family Pleckstrin-homology domain (PH domain) 0.00000109
Further Details:      
 
Domain Number 4 Region: 17-116
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091JLC4
Sequence length 1104
Comment (tr|A0A091JLC4|A0A091JLC4_EGRGA) Rho guanine nucleotide exchange factor 11 {ECO:0000313|EMBL:KFP20738.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_01258 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
LRRLSSLSSLGDSSSERRSPGHHRQPSDSSETTGLVQRCVIIQKDQHGFGFTVSGDRVVL
VQSVRPGGAAMKAGVQEGDRIVKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSPPPSVG
LSSSQQDVSTAGAPRVTPICPPPPPPPPLPPPQRITDPKPLQDPEVQKHATQILRNMLRQ
EEAELQRFCEAYSRNPGTAVEEQIEGARRRVSQLQLKILQETGGSVDSGRLCSNSSLASF
RMMEGRLSLDSQDGDSGLESGTERFPSVSEISLNRNSVLSDHGLDSPRTSPVITARLFQH
HRRQGSDTPFAPSAEQGLDRPGRPLIIGPEEDYDPGYFNNECDSLFQDLGKLKSRPAHLG
VFLRYIFSQADPSPLLFYLCTDVCQQTTAKDSRVLGKDIWNIFLDRNAPLRVKVSEQLLA
EIETRLRNGDDVRAALFEAQEMVMPEIQDQIQDYRTKRTMGLGSLYGENDLLDLDGDPQK
ERQVAEKQLAQLGDILSKYEEDRSSPMAFALSTYMNHTGIRSREPRVAGTSEKAQSLPDR
DKWLPFFPKTKKSSSAKKDKDAMEDKKRNPILKYIGKPKISSQSTFHVPLSPVEAVKPGN
VRNIIQHFENNQHYESQEPGTQRLSTGSFPEDLLESDSSRAEVKLGRSESLKGREEMKKS
RKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPYTPKMGRRSIESPN
LGFGVDPFLPHLLEDEQGQRSDLEPELDSQNWQHTVSRELVANLPQKEIDRQEVINELFA
TEGSHLRILRVLDLLFYQRMKKESLLSREELALLFPNLPDLIEIHNSLSESMKKLREEGP
IIKEIGDLMLSRFDGLAKEEIQQVAADFCSYQSIALELIKTKQRKETRFQIFMQEAESNP
QCRRLQLKDLIISEMQRLTKYPLLLENIIKHTEAGTSEHDKLCRARDQCRDILKYVNEAV
KRAENRHRLEGYQKRLDATSLERTSNPLAAEFKSLDLTSRRMIHEGPLTWRISKDKTVDL
HVLLLEDLLVLLQKQDEKLVLKCHSKTALGSSDNKQTFSPVLKLNSVLIRSVATDKRALF
IICTSELGPQIYELVALTSSEKNT
Download sequence
Identical sequences A0A091JLC4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]