SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JLP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JLP2
Domain Number 1 Region: 296-423
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.9e-41
Family Regulator of G-protein signaling, RGS 0.0000252
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-25
Family DEP domain 0.017
Further Details:      
 
Domain Number 3 Region: 221-285
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 9.81e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091JLP2
Sequence length 429
Comment (tr|A0A091JLP2|A0A091JLP2_EGRGA) Regulator of G-protein signaling 6 {ECO:0000313|EMBL:KFP21492.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_15683 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
IEDIITRMQDDKTGGVPIRTVKSFLSKIPSVVTGADIVQWLMKNLSIEDPGEAIHLGSLI
AAQGYVFPISDHVLTLKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLEL
ADYEAENLARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPG
CVNTTEMDIRKCRRMKNPQKVKKSVYGVTEESQSQSPVHVPSQPVRKTTKEDFRKQITFL
NVQIERHCLKMSKVAESLIAYTEQYVEYDPFITPAEPSNPWISDDAALWDIEMSKEPSQQ
RVKRWGFSMDEVLKDPVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVTTRVEEIW
QEFLAPGAQSAINLDSHSYEKTSQNVKDPGRYTYEDAQEHIYKLMKSDSYARFLRSNAYQ
DLLLAKKKV
Download sequence
Identical sequences A0A091JLP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]