SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JMY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JMY9
Domain Number 1 Region: 787-845
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 2-53
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 555-623
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 679-732
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 732-792
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 625-675
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000772
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 502-560
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000706
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JMY9
Sequence length 888
Comment (tr|A0A091JMY9|A0A091JMY9_EGRGA) ADAMTS-like 2 {ECO:0000313|EMBL:KFP21308.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_13421 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
WWGEWSSWSTCSRSCGGGVMSRERHCLQQRLQMPQGTNSTMCVGQAKHYQLCQQQSCPAN
TASFKQQQCSSFNAKAFGKRYYHWMPLYPDDYTSISNKPCDLQCTTQSGERQLMARAQDG
TSCKDRTYQGVCINGKCEPVGCDGSLYSPRTMDRCRVCGGDGSTCHRVSGSFRKAISQIG
YVFITNIPAGATDILIIERRKTENILALADESGHFFFNGNSAIDNPQNFRVAGTIFKYRR
PSSLNSDGLEYIIAHGPTNQSLNAMYYNFNGKMPHITYDYTVPRIPPLQTAAPAVDRPLY
HHLPETSQSHPIPANSRADQDFNATWLSLSPDDTSEQLPLREGHEDLGFSHPRFFQTNST
SQTQDWGWEQGEEKKYDFQIRQVYHTNTAGEEEEEEATATGRETELGWLLCDKSNLRSIW
ESQTTVQGQSAPAALLRPALRFNQISISTAVPYSMRRSELSENSRIASSRLRLFRRLFSS
AFFHSNEFDVSPVGHDEISLADMYRWKVSAYAPCSSTCTSGISTSYAMCVRYDGVEVDET
YCDALTRPEPTHEFCTGRDCQPRWETSRWSECSRTCGEGYQYRTVRCWKMLAPGFDSSVY
DDLCESAGLARPMERKACKNKACGPQWELSEWSECSARCGTQGTMKREVRCSVETPLCDE
SRKPSSEKACTGPPCDRRWTTSDWGPCSGSCGEGRMSRFIACRNMEGKVISDSQCDPATK
PLAVHPCGDKNCPAHWVEQEWDQCDASCGRGMKTRVVLCAGLENGVYREYPEKRCEASQK
PEEQAACFKRPCSTWFTTSWSQCSKTCGAGVRLREVKCYQGEALAQGCDPTSKPEARQTC
QLQPCPTEAPEEDCEDKATANCVLVLKVKLCSHWYYRKACCQSCRLKS
Download sequence
Identical sequences A0A091JMY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]