SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JPN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JPN8
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Lipocalins 1.18e-37
Family Fatty acid binding protein-like 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JPN8
Sequence length 101
Comment (tr|A0A091JPN8|A0A091JPN8_EGRGA) Fatty acid-binding protein, heart {ECO:0000313|EMBL:KFP21720.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_08930 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
QVGSLTKPTTIIEVAGDKITVKTQSTFKNTEISFKLGEEFDETTADDRHVKSLVTLDGGK
LIHVQKWEGKETSLVRELKDGKLILTLTMGNVVSTRTYEKA
Download sequence
Identical sequences A0A091JPN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]