SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JPZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JPZ3
Domain Number 1 Region: 643-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 563-611
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000068
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 3 Region: 23-77
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 140-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 79-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 702-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000278
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JPZ3
Sequence length 933
Comment (tr|A0A091JPZ3|A0A091JPZ3_EGRGA) Complement component C6 {ECO:0000313|EMBL:KFP23064.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_13340 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
DKTMLMHLILLSLVVGSSQGCYCEHYPWGSWSACSQTCNYGTQTRHRQIRMDEYYSQNFC
DQLCTKQESRACNQQMCPINCRLGDFGPWSECDPCIKKQFRVRRVLRPSQFGGQACTEPL
MDSRPCFPTKLCNIVEVDCKNKFQCESGRCIAKKLECNGENDCGDNSDERNCGRKKTVCN
RKYESIPGVQLIGSGFHILAGESRGEVLGNSFNGGQCTTVKHNETRKSYRVPANLEAVSF
QVTDEEDDVTSDFYNDLTPLSDSADRSSSSIIGTQSSFGIPFLLSRKRRVEVTSSSSFKK
AIEASYEKNSNFIRVHKVISVANFTMKQSDLHLSDVFLKALNHLPLEYNYALYSRIFDEF
GTHYYTSGKMGGSYDVLYQYSSEELQNSGLEVDESTECVLRETTWRVLFIKTKKVSTRCT
TNRMTVKHEGSILESAEQSISLVKGGRSEYAAALAWEKKGVFPGHTVFTNWLESTKDNPV
VIDFEVSPIVDLVKNVPCAMTKRRNLERALREYEGRFNPCQCAPCPNNGRVVLSGTECLC
LCQAGTYGQSCETRAPGYKSVAVDGRWGCWSEWSPCDSSFKTRRTRECNNPAPMNGGKPC
EGEGQEEEDCYVSVFADRGAPCINDDEARREEDVLIGEPESGCSRPDPPENGFIRNEKNQ
YAVGEEVEIACESGHILSGYQFLRCLPDQTWTQQPVECQPSVCLRPPASDSIKISPFKQQ
YSIGETIELSCRAGFKVTGQTQYTCGKDLSWMPPILSSITCEEDVQTKLRGVCNPGQKQV
GSQCVCMSPEEDCGHYSEDICVLHAVSEQNVTKPSCQYSAEMCLGEQSFHFLHAGACRGD
SNLDWAIERAKLSTNSLKKVPCGYDTCYDWEDCPETQTQCSCLMPYQCPKGESRLHCIQM
ESTGRRRAVSHCMLAAMKCAGIKLEVLEQGSCL
Download sequence
Identical sequences A0A091JPZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]