SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JQY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JQY2
Domain Number 1 Region: 1673-1864
Classification Level Classification E-value
Superfamily vWA-like 1.1e-43
Family Integrin A (or I) domain 0.0000204
Further Details:      
 
Domain Number 2 Region: 1473-1645
Classification Level Classification E-value
Superfamily vWA-like 3.81e-40
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 3 Region: 1264-1448
Classification Level Classification E-value
Superfamily vWA-like 3.86e-40
Family Integrin A (or I) domain 0.00000371
Further Details:      
 
Domain Number 4 Region: 645-707
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000834
Family BSTI 0.03
Further Details:      
 
Domain Number 5 Region: 292-346
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000141
Family BSTI 0.026
Further Details:      
 
Domain Number 6 Region: 772-827
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000011
Family ATI-like 0.033
Further Details:      
 
Domain Number 7 Region: 2189-2245
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000123
Family BSTI 0.016
Further Details:      
 
Domain Number 8 Region: 1143-1196
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000262
Family ATI-like 0.075
Further Details:      
 
Domain Number 9 Region: 825-890
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000439
Family Fibronectin type I module 0.07
Further Details:      
 
Domain Number 10 Region: 2561-2641
Classification Level Classification E-value
Superfamily FnI-like domain 0.000068
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JQY2
Sequence length 2805
Comment (tr|A0A091JQY2|A0A091JQY2_EGRGA) von Willebrand factor {ECO:0000313|EMBL:KFP14051.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_06954 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
MLFLAVLLTNLLLASVISGSSGSLLPESSVSRCSLFGNDHIKTFDGSFYYFAGDCSYLLA
GDCHKHSFSLLGDYQDGEKIGFSVYLGEYFNLRFSLDGHVMQEDKRVSIPFASNGVFIEK
ETGYYKISSDEHGFVVKIDISGNIQILLQEKHYNRTCGLCGNFNKFAEDDFRTQEGTLVG
NSYDFANSWALHSENKRCKRVQTPSNTCNISADTAEKGVMETCQLLRTSLTFSRCHHRVD
PEPYINHCERDICACIQGVDCHCTVFLDYARSCAHEGVILDGWPEESSCRPRCPVGMEYK
ECVSPCAKTCQSLNINEVCHGQCVDGCSCPEGKLLDGEHCIESSDCSCIHSGKHYPPGFT
ISQDCNSCICRHGTWICSNGECPGECSVTGQSHFKSFDNKYFTFSGICQYLFAKDCVENS
FSVIIETVQCADDPDAVCTRSASVRIRDMDNSLIKMKHGGGILLNGQDIQIPLLQGALRI
QRTVRTSVRLTYGEDLQIDWDGHGELLLKLSPVYSERMCGLCGNYNGNQGDDFLTPSGMV
EALLEDFGNSWKLNADCQDLLKQDSDPCNLNPRLAKYAEDSCSVLMSSAFEPCHHEVSPT
PYVKNCRFDVCSSSNGKDSLCSSIANYAAACARKSILVQWREPDFCPMTCPEGQVYQQCG
MLCNQTCRSLSYPDEDCDELCVEGCYCPPGQYLDEHEQCVPKSHCSCYYDGEIFQPEDVF
SDHYTMCYCENGFMHCSTNRVPGAFLPDVFADERPSARIKRSLTCRSPMERFVCPANNPR
AEGLECAKTCQNYDLECSSHGCVSGCLCPRGMVRHENKCVAPERCPCFHNGREYAKGETV
TNDCNTCVCRGRKWECTKNTCDGTCMVIGTAHYLTFDGLKYKFPGNCQYVLVQDFCKNDS
GTFRILISNEGCGFTGEKCTKRVIILYESGEIELLNGNVNIKVPPKNDNDLEVMRSGRYY
LIFLGKSISVTWDLAMGVSVILKGTFKDQVCGLCGNFDGIQNNDLTSSNEHLEVDPVDFG
NSWKVNPYCADVEKPNLEQTSTSPLCNGNIVKQVMVETSCSILSGNLFEECKKLVNPEPY
IDICMYDTCACESIGDCACFCDAIAAYAHVCAQKGVAVRWRSPTLCPQSCEDLNKQELDY
QCEWRYNSCGPACPITCQHLQPLECPLQCVEGCHVHCPAGKILDELSLDCVSPEDCPVCA
VGDVKIPHGKRIVLNRDDPQRCQSCLCEGNNLTCIACEPVEDTLTVTTPAPEEDIELPPS
EYSCSKMMDLAFLMDGSNKLSEEDFEQLKTFITGMMKKLHISQKKIRVSILVYRAGPTIY
LGLKDIKTQSQMRKIVQSIKYTGDEIASASEVLKYTVFHVFGKAERTNAARIAVLFIASK
SPGKLRSILTALKNKKIAVMAVGIGPYVNAEQIRFIEKQSPDNRAFLMNNVLELMDNRDL
LIDRLCDLGPEESSLVETTSSPTVSSVLFPPWGLTTTTPISEKPTPKSLDIAFIVEGSDN
VGEENFNIVKKFLEKVITGMNVGQEDIHVTIMQYSETVTLEYSFREIQSKENIIEKVRSI
PYEGGKATNTGNALNYISKHTFTPMNGGRQDVPHLVYMVTSNPSTDVITRHPRSINVIPI
GITPNATIQELRKISQPNNPIILHSYRTLIEEAPELVLQSCCSRKLWTEIPELCNKPVDV
MFLLDGSSNIGASEFEEMKKFVQAFIESVEISNTSTHVSVLQYARENNLEISWNVPQETE
KLIEMVQSIQQREQGPTRLGKAIDFVVQNAMSESHGGRPSASKVAVVIVSGRSEDTVEAA
ALSATMNRVSLFPIGVGNLYDEDQLRTLTGPSAANRIMKLQNFEDLSTMIKLNNEFIKKL
CTDPVRECIDEEGNKKKPGDKWTLRDQCHTVTCFPGEYTVLESHQINCERMPKPVCHSNL
PAVKIEETCGCRWMCPCVCIGSSSRHIVTFDGLNFKLTGNCSYTLFRDMQHDVEVLLHEG
PCRATPKMNCMDSIEVKHRGVSVQLFSDMAVAVNGERVHIPYSSSLFEVNVYGAIMHEIK
FSHLGHNLTFTPRNNEFILKLNSKSFSSGTQGLCGVCDQNHVNDFTLRDGSVTPESSVFI
QNWTVEEPGKICEIQREDRCSEHATSHCRLLLSDQFAECHRVISPNMFYEACAESSCYED
EACEMITSYAHICRENGVCIDWRTPEFCPMKCPTYLTYDHCHKACIKHCENSTKLSVCKD
YPTEGCFCPGGQVIFNDSCVNEEVCTQCISEDGTHHQHMETWIPANEPCQICTCLDNKKV
NCTIRPCPTAKPVQCGPCEVPRLRRDPGQCCPEYECVCDLVSCDLPPAPACEFGLQLALT
NPGECRPNYTCACNREACSFLQRPSCPPHRELTVKKTECCDKYECTCSCTNSTVSCPLGY
LSRSLTNDCGCVSTTCVPGTVCVHNNIVYPIGTTWEDGCRECSCTSMRDDVTGLQMMECH
DKACNTFCSRGYKYIVEEGECCGRCQKTACEEQQFWSRGDADPRLHEVGTEWRSPFNRCI
INECIQVNNEVFVQQKNLSCSQMDVPDCPEGTELRCDQIIDCCPSCRCVPLNGCLLNGTV
IGPWRRLMVDQCTTCVCSFQSTSSRRYTLTCTKLTCEPCPINYRRQEIPGSCCGKCVPTS
CGIRLRDGRLKYLQPNESLQDGCDSHSCKVNEKGEFIWERRITGCPPFDSRRCLAEGGRI
AKIGNTCCDTCLEVECRPVSTRLQYPNINGCVAEKEVPISHCEGKCRSNTRYSVQTGKWE
DLCSCCRASQTTTVTVPLRCANGTVVQHYIPSASQCECYSRNCTD
Download sequence
Identical sequences A0A091JQY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]