SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JSV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JSV8
Domain Number 1 Region: 555-619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000001
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 484-530
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000523
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 3 Region: 24-71
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000772
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 611-667
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000101
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 85-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000564
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091JSV8
Sequence length 832
Comment (tr|A0A091JSV8|A0A091JSV8_EGRGA) Complement component C7 {ECO:0000313|EMBL:KFP23063.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_13339 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
VLGIILLLEVSGFFSIFSSPSPPVHCRWNSFGPWSDCNGCTQKQIRRRTVAVYGQYGGNP
CSGDAFETRPCTPTRGCPTEDGCGDRFRCFSGQCISRSLVCNGDQDCEEDGADEDLCEEK
TTVCDIDKAPPNSELTGAGFDAITGETRGRVIHTKSFGGQCRKVFSGDGREYYRLSESVL
AYTFQVKIENDFSYEFFNSSWSYMKHTERYENSNSGHSNSQDKVLQHSQKSQQLMVIENS
VEVAQFINNRPDFLTLAEPFWKELANLPVVYEYNVYRRLIEHFGTHFLHSGSLGGHYKVI
FYMDTDKMKAEGVSITDMDQCTTSGWNAFIVKKKEVTCSKLDELLRTSSGSSGNKIKGDP
YIEGGSPGAVAGLSYLELNNPAGNSQRYSFWARSVTDYPRVIKQKLTPLYELVKEVPCSS
VKKHYLKQAIEEYMAENDPCKCQPCQNGGEAAVEGTQCVCYCKPYTFGAACELGTLVQDQ
PGVVDGRWSCWSSWSPCSGGRKSRSRTCNNPSPRGGGKACIGEQRDSRPCEDEELQHFRL
IEPHCFDLSITPTEFCSAPPLLENGFVQNAENSYPVGKSIVYACRHGYSLVGNPVAKCGS
DLQWQVGDRYCQETACLLPALEGGLQGEPWKPVYEIGERITLSCPHGMNLEGARSILCEP
SLKWSPDMKNIQCKRPVPSVKPEVTEPKCQPWEKVHQSQCVCKMPYECGPSLDTCATDQR
TKRNTPLTVCKMHALECMGRKYSLTNAENCKIPQAAEIPCGSCRLWEKCDEQSNSCVCDE
DKPCEEEGIQICAEVSGSAARWTMTECEAGQLRCQGETVTLVSIRPCDVESK
Download sequence
Identical sequences A0A091JSV8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]