SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JU53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JU53
Domain Number 1 Region: 1-165
Classification Level Classification E-value
Superfamily C-type lectin-like 9.42e-78
Family Endostatin 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JU53
Sequence length 167
Comment (tr|A0A091JU53|A0A091JU53_EGRGA) Collagen alpha-1(XV) chain {ECO:0000313|EMBL:KFP15141.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_01915 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
LHLVALNSPFSGDMRADFQCFQQAQLVGLTSTYRAFLSSHLQDLATVVRKADRYHLPIVN
LKGEILFNNWESIFNGNGGQFNIHVPIYSFDGRNVMTDPSWPQKVIWHGSTANGIRLVSN
YCEAWHTADMGAMGQASPLKMGKLLDQKIYSCSNQFIVLCIENSFVS
Download sequence
Identical sequences A0A091JU53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]