SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JV65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JV65
Domain Number 1 Region: 36-94
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.00000000000000157
Family Interleukin 8-like chemokines 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091JV65
Sequence length 95
Comment (tr|A0A091JV65|A0A091JV65_COLST) Lymphotactin {ECO:0000313|EMBL:KFP27868.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_02229 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
MKLHAATILVIFWLGVFTVHMVKGSAGSQPMRNLSCVSLSTKQLNIRNLINYEKQQVPVN
AIMFITTKGIRICVSPNQKWVQVAMKKIDQKRTTK
Download sequence
Identical sequences A0A091JV65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]