SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091JY43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091JY43
Domain Number 1 Region: 680-737
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 31-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000445
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 431-488
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 807-871
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 94-166
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 559-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000111
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 171-224
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 8 Region: 735-785
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000126
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 
Domain Number 9 Region: 302-356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000379
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 487-558
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000051
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091JY43
Sequence length 1054
Comment (tr|A0A091JY43|A0A091JY43_COLST) Thrombospondin type-1 domain-containing protein 7A {ECO:0000313|EMBL:KFP29056.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_01477 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
VLLAFSFPGEEVDRQLCRDAIYPIPVVCEAPCPKDCVLSMWSAWSSCSHTCSGKTTEGKQ
MRARSILAYAGEGGIQCPNSSALQETRSCNEHSCTVYHWQTGPWGQCIEDTSVSAFNSSA
SWNGEATCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCRRDCIVTPFSDW
TLCPSSCQEGSVIVKKQSRHRVIIQLPANGGRECPESLFEEKECEASPVCHSYRWKTHKW
RRCQLVPWYVRQDSPGAHETCGPGLQARAITCRRQDGGQADISECLKYSGPLPPLTQTCQ
IPCQDDCQFTNWSKFSSCNGDCGGVRTRKRTLVGKSKKRDKCKNSQLYPLIENQFCPCDK
YSAQPVGNWSDCILPEGKMEVLLGMKIQGDVKECGQGYRYQAMACYDQNNRLVETSRCNS
HGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVN
QVYEVVPCHSDCSQYVWVTEPWSICKVTNVDLKENCGEGVQTRKVRCMLNTVDGPSDTVE
DYLCDPEEMPLGARKCTLPCPEDCVMSEWGSWSRCSLPCNGSSVRERSAGSLRQPDDGKF
CPAAIETEVCTLNKNCYHYYYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDDKSVDLKY
CEELGLEKTWQMNMSCVVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTINQPFQGDGR
PCPSQMEQFKPCPVKPCYRWQYGQWSACKVEDAQCGEGTRMRNITCVVFDGSIEDVGKVV
DEEFCGEIEPIIDGNKKMILDETCTVPCPGDCYLREWSEWSLCQLTCVNGEDLGFGGIQV
RSRAVIIQELENQHLCPEQALETRPCNDGQCYEYKWMASPWKGSSRTVWCQRSDGLNVTG
GCLVMRQPDADRSCNPPCSQPHAYCSETRTCSCEDGYTEVMSSDGTLEQCTLIPVVVIPT
IEDKKGDVKTSRAVNPTQPSNNQSGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLIFIV
SMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences A0A091JY43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]