SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091K4U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091K4U5
Domain Number 1 Region: 22-126
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000051
Family Prefoldin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091K4U5
Sequence length 137
Comment (tr|A0A091K4U5|A0A091K4U5_COLST) Prefoldin subunit 4 {ECO:0000313|EMBL:KFP31351.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_08453 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
SNMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIM
MLDDEDSFLIPYQIGDVFISHSQEETQEMLEEAKKSLQEEIEALESRVESIQRVLSDLKV
QLYAKFGNNINLEAEDS
Download sequence
Identical sequences A0A091K4U5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]