SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091K5V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091K5V7
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-78
Family Protein kinases, catalytic subunit 0.0000155
Further Details:      
 
Domain Number 2 Region: 276-353
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000424
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091K5V7
Sequence length 972
Comment (tr|A0A091K5V7|A0A091K5V7_EGRGA) Mitogen-activated protein kinase kinase kinase 9 {ECO:0000313|EMBL:KFP19156.1} KW=Complete proteome; Reference proteome OX=188379 OS=Egretta garzetta (Little egret). GN=Z169_03416 OC=Coelurosauria; Aves; Neognathae; Pelecaniformes; Ardeidae; Egretta.
Sequence
EIDFSELVLEEIIGIGGFGKVYRAVWIGDEVAVKAARYDPDEDISQTIENVRQEAKLFAM
LKHPNIIALRGVCLKEPNLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIARGMNYLH
EEAIVPIIHRDLKSSNILILEKVENGDLSNKILKITDFGLAREWHKTTKMSAAGTYAWMA
PEVIRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEP
FAKLMEDCWNPDPHSRPSFASILDHLTAIEESGFFEMPKDSFHSLQEDWKQEIQEMFDQL
RAKEKELRTWEEELTRAAVEQKNHEELLRRREQELAEREIDILERELNIIIHQLCQEKPR
VKKRMGKFKRNRLKLKDGNHISLPSDFQHKFTVQASPTMDKRKSLISSCSSPPASPTIIP
RLRAIQCKELNVVLNLGNVHSVLPKEEGEEEEKRGQKKKGRTWGPSSLCHKDLGAGEDGD
SEQITKLHCIHIVHFLPSFHYFSLKALMEGYKQWSSSAPNLGKIQRTAPAFPGFTSLAEM
DDEDSECLNGEGKVHPSPGHNQSYLCIPFQKNEEWDGPSSDANEESTPVNSATSTPQLTP
TNSLKRSGSQHKRCEIALLGCGAVLAAAGLGFDLLEAGKCQLLIEEEPEAPKEEKKKRDS
IFQRAGRPRRSTSPPSRKIFKKDDPMLLLGEPSTSLTLLSLSSISECNSTRSLLRSDSDE
IVVYEMPVSPVTVKAPLPAITNPLVNVQIERFKQDPNQSLTPTHVTVSSHTHQSGHRRTP
SDGAIKGSGLVVNGCPTSGCPSSSCLTGALGAGVLKTPSPSRDPNEVPRLPDPNLVFPPT
PRRWNAQQDPTLERPKTLEFLPRPRPAASRQRLDPWWFVSPSNAKGESSANSSSTDTPSN
LDSCFASSSSTVEERPGLPALLPFQVGLPVEERTLLDIDAEGQSQDSTIPLCRSELNTQK
AAAYELKQEFWS
Download sequence
Identical sequences A0A091K5V7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]