SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KI50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KI50
Domain Number 1 Region: 2-186
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 8.5e-51
Family Nicotinic receptor ligand binding domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 186-391
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 1.06e-50
Family Neurotransmitter-gated ion-channel transmembrane pore 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091KI50
Sequence length 401
Comment (tr|A0A091KI50|A0A091KI50_COLST) Gamma-aminobutyric acid receptor subunit alpha-6 {ECO:0000313|EMBL:KFP27524.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_02342 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
VTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFSGPTEILKLNNLMVSKIWTP
DTFFRNGKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKF
GSYAYPKSEIIYTWKKGPLHSVEVPQESSSLLQYDLIGQTVSSETIKSSTGEYVIMTVYF
HLQRKMGYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSL
PKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQRAMRKAARAAALAAALSAATV
PAEDEIVSHSDSNCNLKKRVNSLASQADQSPEPSIISNTASQCHPVSVPPPGPPPAPPPI
GGTSKIDQYSRILFPVAFAGFNLVYWVVYLSKDTMEVSSRI
Download sequence
Identical sequences A0A091KI50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]