SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KMQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KMQ3
Domain Number 1 Region: 126-466
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.65e-88
Family Protein kinases, catalytic subunit 0.00000000000826
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.52e-26
Family Regulator of G-protein signaling, RGS 0.00000428
Further Details:      
 
Domain Number 3 Region: 493-601
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-25
Family Pleckstrin-homology domain (PH domain) 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091KMQ3
Sequence length 627
Comment (tr|A0A091KMQ3|A0A091KMQ3_9GRUI) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_02078 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
GFLLFKDYCMNEIDEAVPQLKFYEEVSGCGWSFGTARGKRLSRSRQIYDTYIMKELLSCS
HPFSKQAVDHVQTYLAKKQVPANLFQPYIEEICDSLRGKIFQKFMESDKFTRFCQWKNVE
LNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERI
MLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKDMRFYATEI
ILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPEV
LQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDSFSPEL
KSLLEGLLQRDVSKRLGCQGRSAQEVKEHPFFKGIDWQQVYLQKYLPPLIPPRGEVNAAD
AFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYDAVNADTDKIEARKR
AKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLL
TMEQIVSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTEAFTEAQRLLRRA
PKFLNKSRSTVVELSKPPLSHRNSNGL
Download sequence
Identical sequences A0A091KMQ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]