SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KT98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KT98
Domain Number 1 Region: 79-164
Classification Level Classification E-value
Superfamily HMG-box 4.84e-31
Family HMG-box 0.00000676
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 5.5e-26
Family HMG-box 0.00000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091KT98
Sequence length 207
Comment (tr|A0A091KT98|A0A091KT98_9GRUI) High mobility group protein B2 {ECO:0000313|EMBL:KFP43232.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_01577 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
MGKGDPNKPRGKMSSYAYFVQTCREEHKKKHPDSSVNFAEFSRKCSERWKTMSSKEKGKF
EEMAKGDKARYDREMKNYVPPKGEKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKNDHPGL
SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKSKSDAGKKGPGRPAG
SKKKAEPEEEEEEEEEDEEEEEEEDEE
Download sequence
Identical sequences A0A091GCL3 A0A091KT98
XP_009564550.1.62272 XP_010121416.1.88979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]