SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KU21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KU21
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-79
Family Protein kinases, catalytic subunit 0.0000152
Further Details:      
 
Domain Number 2 Region: 278-355
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000836
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091KU21
Sequence length 976
Comment (tr|A0A091KU21|A0A091KU21_9GRUI) Mitogen-activated protein kinase kinase kinase 9 {ECO:0000313|EMBL:KFP44109.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_02569 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
VLEIDFSELVLEEIIGIGGFGKVYRAVWIGDEVAVKAARYDPDEDISQTIENVRQEAKLF
AMLKHPNIIALRGVCLKEPNLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIARGMNY
LHEEAIVPIIHRDLKSSNILILEKVENGDLSNKILKITDFGLAREWHKTTKMSAAGTYAW
MAPEVIRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCP
EPFAKLMEDCWNPDPHSRPSFTSILDHLTAIEESGFFEMPKDSFHSLQEDWKQEIQEMFD
QLRAKEKELRTWEEELSRAAVEQKNHEELLRRREQELAEREIDILERELNIIIHQLCQEK
PRVKKRMGKFKRSRLKLKDGNHISLPSDFQHKFTVQASPTMDKRKSLISSCSSPPASPTI
IPRLRAIQLTPKKSSKTWGRSSVLPKEEGEEEEKRGQKKKGRTWGPSSLCHKELGAGEDG
IQKRGMKIDCGHGTFFFFSPLSFYCFSLKALVEGYKQWSSSAPNLGKIQRTVPAFPGFTS
LAEMDDEDSECLNGEGKVHLSPGHNQSYLCIPFQKNEEWDGPSSDANEESTPVNSATSTP
QLTPTNSLKRSGSHHKRCEVALLGCGAVLAAAGLGFDLLEAGKCQLLIEEEPEAPKEEKK
KRDSIFQRAGRPRRSTSPPSRKIFKKDDPMLLLGEPSTSLTLLSLSSISECNSTRSLLRS
DSDEIVVYEMPISPVTVKAPLPAITNPLVNVQIERFKQDPNQSLTPTHVTLSSHTQQSGH
RRTPSDGAIKGSGLLVNGCPTSGCPSSSCLTGALGAGVLKTPSPSRDPTEVPRLPDPNLV
FPPTPRRWNAQQDPTLERPKTLEFLPRPRPAASRQRLDPWWFVSPSNAKGESSANSSSTD
TPSNLDSCFASSSSTVEERPGLPALLPFQVGLPVEERTLLDIDAEGQSQDSTIPLCRSEL
NTHKAAAYELKQEFWS
Download sequence
Identical sequences A0A091KU21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]