SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KUY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KUY3
Domain Number 1 Region: 54-151
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.32e-35
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000605
Further Details:      
 
Domain Number 2 Region: 229-340
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.49e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091KUY3
Sequence length 352
Comment (tr|A0A091KUY3|A0A091KUY3_9GRUI) Neural Wiskott-Aldrich syndrome protein {ECO:0000313|EMBL:KFP43852.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_07545 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
GPNLPMATVDIKNPEITTNRFYTSQVNNISYTKEKKKGKTKKRRLTKADIGTPSNFQHIG
HVGWDPNTGFDVNNLDPELKNLFDLCGISEAQLKDKETSKVIYDFIEKTGGVEAVKNELR
RQAPPPPPPCRGGPPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTTAPPPPPPSRPGA
TVPPPPPNRMYPPPPPVHSSSAPSGPPPPPPPPASGSSVPPPPPPPPPPPGPPPPPGLPS
EVDHQLPVPAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDG
QESAPATPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWDD
Download sequence
Identical sequences A0A091KUY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]