SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091KVL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091KVL5
Domain Number 1 Region: 260-328
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000327
Family RUN domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091KVL5
Sequence length 330
Comment (tr|A0A091KVL5|A0A091KVL5_COLST) RUN and SH3 domain-containing protein 1 {ECO:0000313|EMBL:KFP31799.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_02703 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
GRGSRSLHSLCCHVAGLTPLSSTRQKFHAFILGLLNTKQLELWICHLQKSPGVVSLLYSP
TAFFALSQGPLPQLADELLLLLQPLSVLTFHLDLLFEHHHLSVDVRPFPGPQVGAVLHET
LQHVLRWGDQLSRALLRAESSQETCRSQADPQDTGLGLSAWWGQLSQASRIDGAPSKEKS
PCVWWTKLGSGAAPPEAEAHGPAAPAKGSWLGGLFGATNPSASPATVSARSRRPSSWLSP
STRVLAMMVKGLVPEKTQVQGEAEKNPPEPPQTHRAVRALCDHTGTADGHLSFQKGDILQ
LLSTVDEDWICCCHGNSTGLVPVGYTSLIL
Download sequence
Identical sequences A0A091KVL5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]