SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L0E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L0E4
Domain Number 1 Region: 41-110
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000418
Family Fibronectin type I module 0.052
Further Details:      
 
Domain Number 2 Region: 170-214
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091L0E4
Sequence length 322
Comment (tr|A0A091L0E4|A0A091L0E4_9GRUI) Protein CYR61 {ECO:0000313|EMBL:KFP45055.1} KW=Complete proteome; Reference proteome OX=187382 OS=Chlamydotis macqueenii (Macqueen's bustard). GN=N324_05485 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Otididae; Chlamydotis.
Sequence
KVCAKQLNEDCSRTQPCDHTKGLECNFGASPAALKGICRAQSEGRPCEYNAKIYQNGESF
QPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPSPRLVKVPGQCCEEWVCDESKDALDEL
EGFFSKEFGLDDSEGELTRNNELIAIVKGGLKMLPVFGSEPQSRAFENPKCIVQTTSWSQ
CSKTCGMGISTRVTNDNPDCKLIKETRICEVRPCGQPSYASLKKGKKCTKTRKSPSPVKF
TYAGCSSLKKYRPKYCGSCVDGRCCTPQQTRTVKIRFRCDDGETFTKSVMMIQSCRCNYN
CPHANEAYPYYRLVNDIHKFRD
Download sequence
Identical sequences A0A091L0E4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]