SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L1G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L1G4
Domain Number 1 Region: 337-515
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-55
Family Regulator of G-protein signaling, RGS 0.000000101
Further Details:      
 
Domain Number 2 Region: 743-925
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-47
Family DBL homology domain (DH-domain) 0.0000000451
Further Details:      
 
Domain Number 3 Region: 22-116
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-22
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091L1G4
Sequence length 926
Comment (tr|A0A091L1G4|A0A091L1G4_COLST) Rho guanine nucleotide exchange factor 11 {ECO:0000313|EMBL:KFP33804.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_04086 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
LCRLSSLSSLGDSSAGRRSPGHRRQPSDSSETTGLVQRCVIIQKDQHGFGFTVSGDRVVL
VQSVRPGGAAMRAGVQEGDRIVKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSPPPSVG
LSSSQQDVSTAGHMAPACPPPPPPPPLPPPQRITDPKPLQDPEVQKHATQILRNMLRQEE
AELQRFYEAYSRNPAPVVEEQIEGARRRVSQLQLKILQETGASMDAGRLCSDSSLAGFRV
MEGRLSLDSQDGDSGLESGTERFPSVSEISLNRNSILSDLESPRTSPVISGRLFQHHRRH
GSDTPSAEQGLERTGRPLIIGPEEDCDLGYFNNECDSLFQDLGKLKSRPAHLGVFLRYIF
SQADPSPLLFYLCTEVCQQTAAKDSRGLGKDIWNIFLDRNAPLRVKVSEQLLADIESRLR
NGDDVRAALFEAQEMVMPEIQEQIQDYRTKRTMGLGSLYGENDLLDLDGDPQKERQVAEK
QLAQLGDILSKYEEDRSSPMAFALSTYMNHTGIRSREPRVAGTSEKAQSLPDRDKWLPFF
PKTKKSSSTKKDKDALEDKKRNPILKYIGKPKISSQSTFHVPLSPVEAVKPGNVRNIIQH
FENNQHYESQEPGTQRLSTGSFPEDLLELDGSRAEVKLGRSESLKGREEMKKSRKAENVP
RSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPYTPKMGRRSIESPNLGFGADP
FLPHLLEDEQGQLSDLEPEMDSQNWQHTVSRELVANLPQKEIDRQEVINELFATEGSHLR
ILRVLDLLFYQRMKKESLLSREELALLFPNLPDLIEIHNSLSESMKKLREEGPIIKEIGD
LMLSRFDGMAKEEIQQVAADFCSYQSIALELIKTKQRKETRFQIFMQEAESNPQCRRLQL
KDLIISEMQRLTKYPLLLENIIKHTE
Download sequence
Identical sequences A0A091L1G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]