SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L4I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L4I2
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.54e-43
Family Reprolysin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 287-341
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000262
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 599-651
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000471
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091L4I2
Sequence length 651
Comment (tr|A0A091L4I2|A0A091L4I2_CATAU) A disintegrin and metalloproteinase with thrombospondin motifs 5 {ECO:0000313|EMBL:KFP50168.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_12281 OC=Cathartes.
Sequence
ADASMVRKYGKGLQHYLLTLASIASRLYAHASLENHVRLAVVKVVALGEKEKGLEVNRNA
ATTLKNFCKWQHQHNRLDDDHDEHYDAPDLCGHHSCDTLGMADVGTICSPERSCAVIEDD
GLHAAFTVAHEIGHLLGLSHDDSKFCEENFGSMEDKRLMSSILTSIDASKPWSKCTSATI
TEFFDDGHGNCLLDQPRKQILGPEELPGQTYDAIRQCKLAFGPEYTVCPGMDVCSRLWCA
VVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKKYYSASSHGNWGSWGPWGQCS
RTCGGGVQFAYRHCNNPAPRNNGRYCTGKRAIYRSCNVGPCPANAKSFRQEQCEARNGYQ
SDAKGVKTFVEWVPKYAGVLPGDVCKLTCRAKGTGYYVVFSQKVSDGTECRPYSNSVCVR
GKCIRTGCDGIIGSKLQYDKCGVCGGDNSSCTKVMGTFTKKSKGYTDVVKIPEGATHIKV
RQFKTKDQSRFTAYLALKKKNGEYLVNGKYMISTSETIIDINGTVMNYSGWSHKDDFLHA
MGHSATKEVLIVQILATDPTQPVDVRYSFFVPKKQGQMTNSVTSSGRRRKVTPQLMQPRW
VTGPWLSCSRTCDTGWHTRTVQCKDGHGKLAKGCLLSQRPSAFKQCLLKKC
Download sequence
Identical sequences A0A091L4I2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]