SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L6P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L6P4
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.14e-35
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 142-219
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000353
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091L6P4
Sequence length 839
Comment (tr|A0A091L6P4|A0A091L6P4_CATAU) Mitogen-activated protein kinase kinase kinase 9 {ECO:0000313|EMBL:KFP50918.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_01583 OC=Cathartes.
Sequence
SPVLILEKVENGDLSNKILKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRSSMFSKGSD
VWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLALPIPSTCPEPFAKLMEDCWNPDPH
SRPSFASILDHLTAIEESGFFEMPKDSFHSLQEDWKQEIQEMFDQLRAKEKELRTWEEEL
TRAAVEQKNHEELLRRREQELAEREIDILERELNIIIHQLCQEKPRVKKRMGKFKRNRLK
LKDGNHISLPSDFQHKFTVQASPTMDKRKSLISSCSSPPASPTIIPRLRAIQLTPAASSK
TWGRSSVLPKEEGEEEEKRGQKKKGRTWGPSSLCHKELGAGEDGAIENIEGGMKIGCKHG
TFSPSFYYFSLKALVEGYKQWSSSAPNLGKIQRTAPAFPGFTSLAEIDDEDSECLNGEGK
VHPSPGHNQSYLCIPFQKNEDWDGPSSDANEESTPVNSATSTPQLTPTNSLKRSGSHHKR
CEVALLGCGAVLAAAGLGFDLLEAGKCQLLIEEEPEAPKEEKKKRDSIFQRAGRPRRSTS
PPSRKIFKKEDPMLLLGEPSTSLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVTV
KAPLPAITNPLVNVQIERFKQDPNQSLTPTHVTVSSHTQQSGHRRTPSDGAIKGSGLVVN
GCPTSGCPSSSCLTGALGAGVLKTPSPSRDPNEVPRLPDPNLVFPPTPRRWNAQQDPTLE
RPKTLEFLPRPRPAASRQRLDPWWFVSPSNAKGESSANSSSTDTPSNLDSCFASSSSTVE
ERPGLPALLPFQVGLPVEERTLLDIDAEGQSQDSTIPLCRSELNTHKAAAYELKQEFWS
Download sequence
Identical sequences A0A091L6P4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]