SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L7W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L7W2
Domain Number 1 Region: 106-210
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000866
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091L7W2
Sequence length 210
Comment (tr|A0A091L7W2|A0A091L7W2_CATAU) Deleted in malignant brain tumors 1 protein {ECO:0000313|EMBL:KFP51225.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_02750 OC=Cathartes.
Sequence
IRLVSGPSRCAGRLEVLWKQQWGTVCDDSWDLADATVVCRQLDCGEALSAPGSAHFGEGT
GHIWLDNMNCTGTEADLSACRTRPWGDHNCNHGEDAGVVCSEMKKPMKLQLVNGSSRCAG
RVEVLYGQQWGTVCDDNWDLIDAEVVCRQLGCGTALSAPSSAYFGGGPDPIWLDDVACNG
TEAALSECSAQPWGSHNCVHGEDAGVVCSG
Download sequence
Identical sequences A0A091L7W2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]