SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L8F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L8F6
Domain Number 1 Region: 1-19,138-332
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.51e-62
Family G proteins 0.00000000587
Further Details:      
 
Domain Number 2 Region: 23-144
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.49e-36
Family Transducin (alpha subunit), insertion domain 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091L8F6
Sequence length 334
Comment (tr|A0A091L8F6|A0A091L8F6_CATAU) Guanine nucleotide-binding protein G(S) subunit alpha {ECO:0000313|EMBL:KFP51485.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_03263 OC=Cathartes.
Sequence
LGAGESGKSTIVKQMRILHVNGFNAEEKKMKIQDIKNNIKEAIETIVTAMGNLAPPVELA
NPENQFRIDYILNLANQIDFDFPPEFYEHTKTLWQDEGVKACYERSNEYQLIDCAQYFLD
KIDIVKQNEYTPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPDDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Download sequence
Identical sequences A0A087V2Q7 A0A091E565 A0A091I554 A0A091JJR8 A0A091L8F6 A0A091Q9Y1 A0A091QGC5 A0A091U9V2 A0A091W3V3 A0A091W673 A0A093DPH9 A0A093GQU8 A0A093H0K7 A0A093PF62 A0A093RDL9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]